PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00389.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 483aa    MW: 55302.1 Da    PI: 6.6328
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00389.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.5e-5561331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeel+++yLk+k++g ++el evi+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratksgyWk
  Rsa1.0_00389.1_g00001.1   6 LPPGFRFHPTDEELITYYLKRKINGLEIEL-EVIAEVDLYKCEPWDLPgKsLLPSKDQEWYFFSPRDRKYPNGSRTNRATKSGYWK 90 
                              79****************************.99***************6345667999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v   +++++g+kktLv+y+grap+g +t Wvmheyrl
  Rsa1.0_00389.1_g00001.1  91 ATGKDRRVSW-RDRAIGTKKTLVYYRGRAPQGIRTGWVMHEYRL 133
                              *********9.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-634157IPR003441NAC domain
PROSITE profilePS5100561.1336157IPR003441NAC domain
PfamPF023652.8E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MSPVSLPPGF RFHPTDEELI TYYLKRKING LEIELEVIAE VDLYKCEPWD LPGKSLLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRRVSW RDRAIGTKKT LVYYRGRAPQ  120
GIRTGWVMHE YRLDENECEP SAYGMQDAYA LCRVFKKIVI EAKTRDQHRS YIHAMSNVSG  180
TSSFDPCSDL EISLSTHQVQ NAFQPQFGNR RFNSNPSNEN WSQYYGSSYP PIPTPYKVNN  240
EIECSMLQHN ISLPPLRIDN SAVSNNNFYN TSTTHNNNHG VLEDFTFAAS NSNYYNNTVG  300
DQVIHIGNYD EPLITSNNYM NQVYIEEQKI ISTLDDNNQD HGFQGDNTNI NIHIDEFLSF  360
DMYNDENVNR VEGNEEDVNI NEAVDSSGFE GFGFYDTRAR APEHQRASID SLNRDLLRTR  420
PPHTRADPSY SASTSKETKP ATTTAKETVR PQSQSPAIHQ AGDAMPKPKK KNKERGPRVT  480
LPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-56115712165NAC domain-containing protein 19
4dul_A1e-56115712165NAC domain-containing protein 19
1ut7_B1e-56115712165NO APICAL MERISTEM PROTEIN
1ut7_A1e-56115712165NO APICAL MERISTEM PROTEIN
1ut4_B1e-56115712165NO APICAL MERISTEM PROTEIN
1ut4_A1e-56115712165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130344.10.0PREDICTED: protein BEARSKIN1 isoform X2
RefseqXP_013732325.10.0PREDICTED: NAC domain-containing protein 45-like
SwissprotA4VCM00.0NAC45_ARATH; NAC domain-containing protein 45
TrEMBLM4ET790.0M4ET79_BRARP; Uncharacterized protein
STRINGBra032009.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.10.0NAC domain containing protein 45